GHRP-6
Triveni Exports Pvt. Ltd.
Mumbai, India


Peptides Wholesale


For Export Only! We don't Sell in India. 100% Genuine Peptides Exporter. We mainly export in USA, UK, Australia, China, UAE, Dubai, Russia, France, Japan, Africa & European Countries. India Peptides wholesale supplier.



GHRP-6 is a potent stimulator of natural Growth Hormone release. GHRP-6 is a Hexa-peptide that promotes food intake by stimulating hunger and helps increase energy metabolism. GHRP-6 increases the natural production of human growth hormone in the body and thus have the same positive effects as synthetic human growth hormone such as fat loss,...

Yes! I am interested


Ansomone 40iu 191aa Human Growth Hormone kit for sale. Original Ansomone 40iu by Anhui Anke Biotechnology is a lyophilized (freeze-dried) white powder packed in a sealed box containing 10 x 4 iu/vials. Brand Name: Ansomone Kit: 40iu (10 vials x 4iu/vial) Company: Anhui Anke Biotechnology Ansomone 40iu is a brand name and is 100%...

Yes! I am interested


Ansomone 100iu 191aa Human Growth Hormone kit for sale. Original Ansomone 100iu by Anhui Anke Biotechnology is a lyophilized (freeze-dried) white powder packed in a sealed box containing 10 x 10 iu/vials. Brand Name: Ansomone Kit: 100iu (10 vials x 10iu/vial) Company: Anhui Anke Biotechnology Ansomone 100iu is a brand name and is 100%...

Yes! I am interested


Hygetropin 100iu (Hygetropin Black Tops). Original Hygetropin 100iu kit by HygenePharma Brand Name: Hygetropin Kit: 100iu (10 vials x 10iu/vial) Company: HygenePharma Every box comes with a verification code that can be checked on www.hygenepharma.com Hygetropin is a brand name and is 100% pharmaceutical made in a lic. company. Each batch is tested before sales....

Yes! I am interested


Hexarelin 2mg, Hexarelin (HEX) is a peptide GH secretagogue with a potent ability to stimulate GH secretion and recently reported cardioprotective actions. Because Hexarelin’s amino acid sequence may help in promoting the body to produce more Growth Hormone, it will not shut down the body’s own production. Unit Size: 5 mg/vial CAS NO.: 140703-51-1...

Yes! I am interested


Hexarelin 2mg, Hexarelin (HEX) is a peptide GH secretagogue with a potent ability to stimulate GH secretion and recently reported cardioprotective actions. Because Hexarelin’s amino acid sequence may help in promoting the body to produce more Growth Hormone, it will not shut down the body’s own production. Unit Size: 2 mg/vial CAS NO.: 140703-51-1...

Yes! I am interested


CJC-1295 With DAC 2mg, Basically CJC-1295 is a long acting growth hormone releasing hormone (GHRH) analog. GHRH, also known as growth hormone releasing factor or somatocrinin, is 44-amino acid peptide hormone which is produced by the arcuate nucleus in the hypothalamus. It stimulates secretion of growth hormone from the pituitary gland and is released...

Yes! I am interested


BPC-157 5mg, Pentadecapeptide BPC 157, composed of 15 amino acids, is a partial sequence of body protection compound (BPC) that is discovered in and isolated from human gastric juice. Experimentally it has been demonstrated to accelerate the healing of many different wounds, including transected rat Achilles tendon. This study was designed to investigate the...

Yes! I am interested


Ipamorelin 5mg, is a pentapeptide (Aib-His-D-2-Nal-D-Phe-Lys-NH2), which displays high GH releasing potency and efficacy in vitro and in vivo. Ipamorelin does not release acetylcholine (ACTH) or cortisol in amounts or concentrations that are similar with those observed after the stimulation of GHRH. Unit Size: 5 mg/vial CAS NO.: 170851-70-4 Synonyms: Ipamorelin Molecular Formula: C38H49N9O5...

Yes! I am interested


Ipamorelin 2mg, is a pentapeptide (Aib-His-D-2-Nal-D-Phe-Lys-NH2), which displays high GH releasing potency and efficacy in vitro and in vivo. Ipamorelin does not release acetylcholine (ACTH) or cortisol in amounts or concentrations that are similar with those observed after the stimulation of GHRH. Unit Size: 2 mg/vial CAS NO.: 170851-70-4 Synonyms: Ipamorelin Molecular Formula: C38H49N9O5...

Yes! I am interested


GHRP-2 5mg, (also known as KP 102 or Pralmorelin) is a synthetic hexapeptide Growth Hormone Releasing Peptide (GHRP), which acts on the hypothalamus and the pituitary gland to release growth hormone with a slight stimulator effect on Prolactin, ACTH and Cortisol levels. GHRP-2 is considered to be a true hGH secretagogue, meaning that it...

Yes! I am interested


IGF-1 LR3 1mg, allows for many of the growth-promoting effects of growth hormone insulin-like growth factors also know as IGF’s. IGF-1 LR3 comprises a family of peptides (protiens) that play important roles in mammalian growth and development. IGF1 LR3 is also known as Long R3 IGF-1 or Insulin-Like Growth Factor-I Long Arg3. The Long...

Yes! I am interested


Oxytocin 2mg, is a mammalian hormone that acts primarily as a neuromodulator in the brain. Oxytocin is best known for its roles in sexual reproduction, in particular during and after childbirth. The oxytocin peptide is synthesized as an inactive precursor protein from the OXT gene. Oxytocin is a peptide of nine amino acids (a...

Yes! I am interested


Sermorelin 2mg, sometimes called GRF 1-29 NH2 with sequence YADAIFTNSYRKVLGQLSARKLLQDIMNR-NH2, is an amidated synthetic 29-amino acid polypeptide that corresponds to the amino-terminal segment of the naturally occurring human growth hormone-releasing hormone (GHRH or GRF) consisting of 44 amino acid residues. It is used as a test for growth hormone secretion and often used extensively...

Yes! I am interested


Follistatin 344 1mg Follistatin (FST) is a secreted glycoprotein that was first identified as a follicle­stimulating hormone inhibiting substance in ovarian follicular fluid (1, 2). Unit Size: 1 mg/vial Uniprot ID: P19883 Synonyms: Follistatin, Activin-binding protein, FST Appearance: White Powder Purity: 98.31% Source: Organic Storage: Lyophilized Follistatin is stable at room temperature for 90...

Yes! I am interested